LL?37 is the only human?derived cathelicidin cationic antimicrobial peptide, CAS 154947?66?7. It is a 37?amino?acid amphipathic α?helical peptide cleaved from precursor protein hCAP?18. Amino?acid sequence: [LL-37, 37 aa], molecular formula C???H???N??O??, molecular weight 4493.34 g/mol. Supplied as white lyophilized powder with HPLC purity ≥98%.

Produced by solid?phase peptide synthesis and reversed?phase HPLC purification. Strict quality control including HPLC purity test, MS molecular weight confirmation, endotoxin test and sequence verification. Our LL?37 peptide features low endotoxin, stable batch?to?batch performance and good water solubility, meeting international research?grade peptide standards.